Rabbit Polyclonal Anti-FUSIP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUSIP1 antibody: synthetic peptide directed towards the C terminal of human FUSIP1. Synthetic peptide located within the following region: TDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSS |
Rabbit Polyclonal Anti-FUSIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUSIP1 antibody: synthetic peptide directed towards the C terminal of human FUSIP1. Synthetic peptide located within the following region: KSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEK |
Rabbit Polyclonal Anti-FUSIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUSIP1 antibody: synthetic peptide directed towards the N terminal of human FUSIP1. Synthetic peptide located within the following region: MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRP |
Rabbit Polyclonal FUSIP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 100-200). [Swiss-Prot# O75494] |
Germany
Japan
United Kingdom
China
