Antibodies

View as table Download

Rabbit Polyclonal Anti-SR140 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SR140 antibody: synthetic peptide directed towards the N terminal of human SR140. Synthetic peptide located within the following region: NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF

Rabbit Polyclonal Anti-SR140 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SR140 antibody: synthetic peptide directed towards the middle region of human SR140. Synthetic peptide located within the following region: KVAPSKWEAVDESELEAQAVTTSKWELFDQHEESEEEENQNQEEESEDEE