Antibodies

View as table Download

Rabbit Polyclonal Anti-H2AFY Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H2AFY antibody: synthetic peptide directed towards the N terminal of human H2AFY. Synthetic peptide located within the following region: HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV

Rabbit Polyclonal Anti-H2AFY Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H2AFY antibody: synthetic peptide directed towards the middle region of human H2AFY. Synthetic peptide located within the following region: PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG

Rabbit Polyclonal Anti-H2AFY Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H2AFY antibody: synthetic peptide directed towards the N terminal of human H2AFY. Synthetic peptide located within the following region: MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA