Rabbit Polyclonal Anti-FANCL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FANCL Antibody: synthetic peptide directed towards the middle region of human FANCL. Synthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY |
Goat Anti-FANCL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QNLKDVLEIDFP, from the internal region of the protein sequence according to NP_001108108.1; NP_060532.2. |
Rabbit polyclonal anti-FANCL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FANCL |
Rabbit polyclonal anti-FANCL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FANCL |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
