PERP Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | PERP antibody was raised against synthetic peptide from human PERP. |
PERP Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | PERP antibody was raised against synthetic peptide from human PERP. |
Rabbit Polyclonal PERP Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | PERP antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy terminus of human PERP, which differ from the mouse sequence by three amino acids (7-9) . |
Goat Polyclonal Antibody against PERP
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CLPNYEDDLLGNAK, from the C Terminus of the protein sequence according to NP_071404.2. |
Rabbit Polyclonal Anti-PERP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PERP antibody: synthetic peptide directed towards the middle region of human PERP. Synthetic peptide located within the following region: FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG |