Chicken Polyclonal DRGX Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DRGX antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human DRGX. |
Chicken Polyclonal DRGX Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DRGX antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human DRGX. |
Rabbit Polyclonal Anti-DRGX Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DRGX antibody: synthetic peptide directed towards the N terminal of human DRGX. Synthetic peptide located within the following region: MVLMSCDQRLISLLLVGTATFGNHSSGDFDDGFLRRKQRRNRTTFTLQQL |
Rabbit Polyclonal Anti-DRGX Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DRGX antibody: synthetic peptide directed towards the middle region of human DRGX. Synthetic peptide located within the following region: KEPMAEVTPPPVRNINSPPPGDQARSKKEALEAQQSLGRTVGPAGPFFPS |
Carrier-free (BSA/glycerol-free) DRGX mouse monoclonal antibody,clone OTI2C11
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
DRGX rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DRGX |
DRGX mouse monoclonal antibody,clone OTI2C11
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
DRGX mouse monoclonal antibody,clone OTI2C11, Biotinylated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
DRGX mouse monoclonal antibody,clone OTI2C11, HRP conjugated
Applications | WB |
Reactivities | Human, Rat |
Conjugation | HRP |
DRGX mouse monoclonal antibody,clone OTI2C11
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |