Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against DUSP8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence *AGDRLPRKVMDAK-C, from the N Terminus of the protein sequence according to NP_004411.1. |
Rabbit Polyclonal Anti-DUSP8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DUSP8 antibody: synthetic peptide directed towards the middle region of human DUSP8. Synthetic peptide located within the following region: PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP |
Anti-DUSP8 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human dual specificity phosphatase 8 |
DUSP8 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DUSP8 |
| Modifications | Unmodified |
Active filters
Target Symbol
- DUSP8
Reactivities
- Human