Antibodies

View as table Download

Rabbit Polyclonal LRRTM1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LRRTM1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human LRRTM1.

Rabbit Polyclonal Anti-LRRTM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LRRTM1 Antibody: synthetic peptide directed towards the middle region of human LRRTM1. Synthetic peptide located within the following region: RIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAH

Rabbit Polyclonal Anti-LRRTM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LRRTM1 Antibody: synthetic peptide directed towards the middle region of human LRRTM1. Synthetic peptide located within the following region: CALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSG

Carrier-free (BSA/glycerol-free) LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LRRTM1 mouse monoclonal antibody, clone OTI5H9 (formerly 5H9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), Biotinylated

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Biotin

LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), HRP conjugated

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation HRP

LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LRRTM1 mouse monoclonal antibody, clone OTI5H9 (formerly 5H9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LRRTM1 mouse monoclonal antibody, clone OTI5H9 (formerly 5H9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated