Antibodies

Jump to Filters
View as table Download
MTR Goat Polyclonal Antibody
TA302710

USD 375.00

In Stock

Goat Polyclonal Antibody against MTR

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245.
MTR Rabbit Polyclonal Antibody
TA346670

USD 475.00

5 Days

Rabbit Polyclonal Anti-MTR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTR antibody: synthetic peptide directed towards the C terminal of human MTR. Synthetic peptide located within the following region: GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL
MTR Rabbit Polyclonal Antibody
TA378787

USD 220.00

3 Weeks

MTR Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1056-1265 of human MTR (NP_000245.2).
Modifications Unmodified