Antibodies

View as table Download

Rabbit Polyclonal Anti-OR1S1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR1S1 antibody: synthetic peptide directed towards the C terminal of human OR1S1. Synthetic peptide located within the following region: FSTCGSHLTVVLLFYGTIVGVYFFPSSTHPEDTDKIGAVLFTVVTPMINP

Rabbit Polyclonal Anti-OR1S1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR1S1 antibody: synthetic peptide directed towards the C terminal of human OR1S1. Synthetic peptide located within the following region: FPSSTHPEDTDKIGAVLFTVVTPMINPFIYSLRNKDMKGALRKLINRKIS