Antibodies

Jump to Filters
View as table Download
SCN1B Rabbit Polyclonal Antibody
TA338513

USD 375.00

5 Days

Rabbit Polyclonal Anti-SCN1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN1B antibody: synthetic peptide directed towards the middle region of human SCN1B. Synthetic peptide located within the following region: NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS
SCN1B Rabbit Polyclonal Antibody
TA351633

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-SCN1B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCN1B
SCN1B Rabbit Polyclonal Antibody
TA367236

USD 380.00

4 Weeks

SCN1B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCN1B
SCN1B Rabbit Polyclonal Antibody
TA381287

USD 220.00

3 Weeks

SCN1B Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human SCN1B (NP_950238.1).
Modifications Unmodified