Rabbit Polyclonal Anti-SUV39H1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUV39H1 antibody: synthetic peptide directed towards the C terminal of human SUV39H1. Synthetic peptide located within the following region: FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF |
Rabbit Polyclonal Anti-SUV39H1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUV39H1 antibody: synthetic peptide directed towards the N terminal of human SUV39H1. Synthetic peptide located within the following region: RHLDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPP |
SUV39H1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SUV39H1 |
SUV39H1 Rabbit polyclonal Antibody
| Applications | ChIP, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SUV39H1 (NP_003164.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
