OR10H5 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 244-273 amino acids from the C-terminal region of human OR10H5 |
OR10H5 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 244-273 amino acids from the C-terminal region of human OR10H5 |
Rabbit Polyclonal Anti-OR10H5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR10H5 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10H5. Synthetic peptide located within the following region: NKAFSTCASHLTVVVVHYGFASVIYLKPKGPQSPEGDTLMGITYTVLTPF |