Antibodies

View as table Download

Goat Anti-UNC5C Antibody

Applications IF
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence NCTVSEEPTGID, from the internal region of the protein sequence according to NP_003719.2.

UNC5C (Center) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human UNC5C

Rabbit Polyclonal Anti-UNC5C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC5C antibody is: synthetic peptide directed towards the middle region of Human UNC5C. Synthetic peptide located within the following region: EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFE

Rabbit Polyclonal Anti-UNC5C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC5C antibody: synthetic peptide directed towards the middle region of human UNC5C. Synthetic peptide located within the following region: VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTS

Rabbit Polyclonal Anti-UNC5C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC5C antibody: synthetic peptide directed towards the C terminal of human UNC5C. Synthetic peptide located within the following region: WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE

UNC5C Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human UNC5C

UNC5C rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UNC5C

UNC5C Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-360 of human UNC5C (NP_003719.3).
Modifications Unmodified