Antibodies

View as table Download

ABCC9 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABCC9

Mouse Monoclonal Anti-SUR2A Antibody

Reactivities Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ABCC9 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC9 Antibody: synthetic peptide directed towards the middle region of human ABCC9. Synthetic peptide located within the following region: AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK

Rabbit Polyclonal Anti-ABCC9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABCC9