Antibodies

Jump to Filters
View as table Download
PHAPI2 / APRIL (ANP32B) Goat Polyclonal Antibody
TA302570

USD 375.00

5 Days

Goat Polyclonal Antibody against PHAPI2 / APRIL

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KRKRETDDEGEDD, from the C Terminus of the protein sequence according to NP_006392.1.
PHAPI2 / APRIL (ANP32B) Rabbit Polyclonal Antibody
TA312317

USD 345.00

4 Weeks

Rabbit polyclonal anti-ANP32B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ANP32B.
PHAPI2 / APRIL (ANP32B) Rabbit Polyclonal Antibody
TA340107

USD 375.00

5 Days

Rabbit Polyclonal Anti-ANP32B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANP32B antibody: synthetic peptide directed towards the N terminal of human ANP32B. Synthetic peptide located within the following region: GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE
PHAPI2 / APRIL (ANP32B) Rabbit Polyclonal Antibody
TA359416

USD 360.00

5 Days

ANP32B Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human AN32B