DCAF12 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DCAF12 |
DCAF12 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DCAF12 |
Chicken Polyclonal TCC52 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TCC52 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human TCC52. |
DCAF12 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 222-252 amino acids from the Central region of human WDR40A |
Rabbit Polyclonal Anti-DCAF12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WDR40A antibody: synthetic peptide directed towards the middle region of human WDR40A. Synthetic peptide located within the following region: TKSDARHNVSRVPVYAHITHKALKDIPKEDTNPDNCKVRALAFNNKNKEL |
Rabbit Polyclonal Anti-DCAF12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WDR40A antibody: synthetic peptide directed towards the N terminal of human WDR40A. Synthetic peptide located within the following region: ARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLK |
DCAF12 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human DCAF12 (NP_056212.1). |
Modifications | Unmodified |