Antibodies

View as table Download

FAM50A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human FAM50A

FAM50A mouse monoclonal antibody, clone 5F10

Applications ELISA, IHC, WB
Reactivities Human, Rat

Rabbit polyclonal antibody to FAM50A (family with sequence similarity 50, member A)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 149 and 339 of FAM50A (Uniprot ID#Q14320)

Rabbit polyclonal FAM50A Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FAM50A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 311-339 amino acids from the C-terminal region of human FAM50A.

Rabbit Polyclonal Anti-FAM50A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM50A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM50A. Synthetic peptide located within the following region: LLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR

FAM50A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human FAM50A

FAM50A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human FAM50A