FAM50A rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FAM50A |
FAM50A rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FAM50A |
FAM50A mouse monoclonal antibody, clone 5F10
Applications | ELISA, IHC, WB |
Reactivities | Human, Rat |
Rabbit polyclonal antibody to FAM50A (family with sequence similarity 50, member A)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 149 and 339 of FAM50A (Uniprot ID#Q14320) |
Rabbit polyclonal FAM50A Antibody (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FAM50A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 311-339 amino acids from the C-terminal region of human FAM50A. |
Rabbit Polyclonal Anti-FAM50A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-FAM50A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM50A. Synthetic peptide located within the following region: LLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR |
FAM50A Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FAM50A |
FAM50A rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FAM50A |