Rabbit Polyclonal LRRTM1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LRRTM1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human LRRTM1. |
Rabbit Polyclonal LRRTM1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LRRTM1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human LRRTM1. |
LRRTM1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 95~125 amino acids from the Central region of human LRRTM1 |
Rabbit Polyclonal Anti-LRRTM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LRRTM1 Antibody: synthetic peptide directed towards the middle region of human LRRTM1. Synthetic peptide located within the following region: RIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAH |
Rabbit Polyclonal Anti-LRRTM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LRRTM1 Antibody: synthetic peptide directed towards the middle region of human LRRTM1. Synthetic peptide located within the following region: CALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSG |
Carrier-free (BSA/glycerol-free) LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LRRTM1 mouse monoclonal antibody, clone OTI5H9 (formerly 5H9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LRRTM1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LRRTM1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LRRTM1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LRRTM1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LRRTM1 mouse monoclonal antibody, clone OTI5H9 (formerly 5H9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LRRTM1 mouse monoclonal antibody, clone OTI5H9 (formerly 5H9), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
LRRTM1 mouse monoclonal antibody, clone OTI5H9 (formerly 5H9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LRRTM1 mouse monoclonal antibody, clone OTI5H9 (formerly 5H9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |