Rabbit Polyclonal Anti-MLN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MLN Antibody: synthetic peptide directed towards the middle region of human MLN. Synthetic peptide located within the following region: LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLE |
Rabbit polyclonal anti Motilin (canine); neat antiserum
| Applications | ELISA |
| Reactivities | Canine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg- Met-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln-NH2 coupled to carrier protein. |
Rabbit polyclonal anti canine/human/porcine Motilin
| Applications | ELISA |
| Reactivities | Canine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg- Met-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Motilin (canine); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Canine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg- Met-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln-NH2 coupled to a carrier protein. |
MLN rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MLN |
MLN Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-115 of human MLN (NP_002409.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
