Germany
Japan
United Kingdom
China
OR10J3 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 5-33 amino acids from the N-terminal region of Human Olfactory receptor 10J3 |
Antibodies
View as table Download
Rabbit polyclonal anti-OR10J3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR10J3. |
Rabbit Polyclonal Anti-OR10J3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR10J3 Antibody is synthetic peptide directed towards the C-terminal region of Human OR10J3. Synthetic peptide located within the following region: HLTVVIIHYGCASIIYLKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEE |
Active filters
Target Symbol
- OR10J3