Rabbit polyclonal Anti-PPOX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPOX antibody: synthetic peptide directed towards the N terminal of human PPOX. Synthetic peptide located within the following region: SSERLGGWIRSVRGPNGAIFELGPRGIRPAGALGARTLLLVSELGLDSEV |
Rabbit polyclonal Anti-PPOX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPOX antibody is: synthetic peptide directed towards the C-terminal region of Human PPOX. Synthetic peptide located within the following region: GGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGKEPDETVHSFAQ |
PPOX rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PPOX |
PPOX Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PPOX (NP_001116236.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
