Rabbit Polyclonal Anti-PRDM9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDM9 antibody: synthetic peptide directed towards the middle region of human PRDM9. Synthetic peptide located within the following region: CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP |
Goat Polyclonal Prdm9 (rat aa440-451)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QEHFDSQNKNDK, from the internal region of the protein sequence according to NP_001102373.2 |
PRDM9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRDM9. |
| Modifications | Unmodified |
Prdm9 Rabbit polyclonal Antibody
| Applications | ChIP, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of mouse Prdm9. |
| Modifications | Unmodified |
Recombinant Anti-PRDM9 (Clone RAB-C370)
| Applications | ChIP, ELISA, IF |
| Reactivities | Human |
| Conjugation | His Tag |
Recombinant Anti-PRDM9 (Clone RAB-C370)
| Applications | ChIP, ELISA, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. |
Germany
Japan
United Kingdom
China
