Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SEC13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SEC13 antibody is: synthetic peptide directed towards the middle region of Human SEC13. Synthetic peptide located within the following region: GHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDS |
Rabbit Polyclonal Anti-SEC13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEC13 antibody is: synthetic peptide directed towards the C-terminal region of Human SEC13. Synthetic peptide located within the following region: IKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRV |
SEC13 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SEC13 |
SEC13 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-322 of human SEC13 (NP_899195.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SEC13