Antibodies

View as table Download

Rabbit anti-SMARCA5 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SMARCA5

Rabbit Polyclonal anti-SMARCA5 antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMARCA5 antibody: synthetic peptide directed towards the N terminal of human SMARCA5. Synthetic peptide located within the following region: AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE

Rabbit Polyclonal Anti-SMARCA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMARCA5 antibody: synthetic peptide directed towards the N terminal of human SMARCA5. Synthetic peptide located within the following region: SSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAVSA

Mouse Monoclonal Snf2h Antibody

Applications WB
Reactivities Human

Mouse Monoclonal Snf2h Antibody

Applications WB
Reactivities Human

Rabbit polyclonal anti-SNF2H antibody

Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen SNF2H

Rabbit Polyclonal Anti-SMARCA5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SMARCA5

SMARCA5 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human SNF2H

SMARCA5 Rabbit monoclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated