Rabbit Polyclonal Anti-THOC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THOC3 antibody: synthetic peptide directed towards the middle region of human THOC3. Synthetic peptide located within the following region: PDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLT |
Rabbit Polyclonal Anti-THOC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THOC3 antibody: synthetic peptide directed towards the middle region of human THOC3. Synthetic peptide located within the following region: LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND |
THOC3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human THOC3 |
THOC3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human THOC3 (NP_115737.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
