Antibodies

Jump to Filters
View as table Download
ARHGAP30 Rabbit Polyclonal Antibody
TA334958

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARHGAP30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARHGAP30 antibody: synthetic peptide directed towards the N terminal of human ARHGAP30. Synthetic peptide located within the following region: RKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAG
ARHGAP30 Rabbit Polyclonal Antibody
TA373652

USD 220.00

3 Weeks

ARHGAP30 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 485-585 of human ARHGAP30 (NP_859071.2).
Modifications Unmodified