Rabbit Polyclonal anti-C6orf134 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C6orf134 antibody: synthetic peptide directed towards the N terminal of human C6orf134. Synthetic peptide located within the following region: MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL |
Rabbit Polyclonal anti-C6orf134 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C6orf134 antibody: synthetic peptide directed towards the N terminal of human C6orf134. Synthetic peptide located within the following region: MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL |
Rabbit Polyclonal anti-C6orf134 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C6orf134 antibody: synthetic peptide directed towards the middle region of human C6orf134. Synthetic peptide located within the following region: DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID |
ATAT1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATAT1 |
Germany
Japan
United Kingdom
China