Antibodies

View as table Download

Rabbit polyclonal anti-Stefin B antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human stefin B.

Rabbit Polyclonal Anti-CSTB Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CSTB Antibody: A synthesized peptide derived from human CSTB

Rabbit Polyclonal Anti-CSTB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSTB antibody: synthetic peptide directed towards the middle region of human CSTB. Synthetic peptide located within the following region: AGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Rabbit Polyclonal Anti-CSTB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSTB antibody: synthetic peptide directed towards the N terminal of human CSTB. Synthetic peptide located within the following region: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAG

Goat Anti-Cystatin B / Stefin B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QTNKAKHDELTYF, from the C Terminus of the protein sequence according to NP_000091.1.

Carrier-free (BSA/glycerol-free) CSTB mouse monoclonal antibody,clone OTI1E8

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CSTB mouse monoclonal antibody,clone OTI1F12

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CSTB mouse monoclonal antibody,clone OTI2A7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CSTB mouse monoclonal antibody,clone OTI3D5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CSTB mouse monoclonal antibody,clone OTI5F2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CSTB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CSTB

CSTB rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CSTB

CSTB Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human CSTB (NP_000091.1).
Modifications Unmodified