Rabbit Polyclonal Anti-DDX27 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX27 antibody: synthetic peptide directed towards the N terminal of human DDX27. Synthetic peptide located within the following region: DEKIEKVRKKRKTEDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSE |
Rabbit Polyclonal Anti-DDX27 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX27 antibody: synthetic peptide directed towards the N terminal of human DDX27. Synthetic peptide located within the following region: DLGLIGTIGEDDEVPVEPESDSGDEEEEGPIVLGRRQKALGKNRSADFNP |
Germany
Japan
United Kingdom
China
