Goat Polyclonal Anti-TICAM-1 / TRIF Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TICAM-1 / TRIF Antibody: Peptide with sequence PDGATFCEDFQVP, from the internal region of the protein sequence according to NP_891549.1. |
Rabbit Polyclonal Anti-FCRL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FCRL1 antibody: synthetic peptide directed towards the N terminal of human FCRL1. Synthetic peptide located within the following region: MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQF |
Germany
Japan
United Kingdom
China