Antibodies

Jump to Filters
View as table Download
IL27 Rabbit Polyclonal Antibody
TA332726

USD 275.00

In Stock

Rabbit anti-IL27 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human IL27
IL27 Rabbit Polyclonal Antibody
TA306316

USD 430.00

5 Days

Rabbit Polyclonal IL-27 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IL-27 antibody was raised against a 16 amino acid peptide from near the amino terminus of human IL-27.
IL27 Rabbit Polyclonal Antibody
TA306317

USD 430.00

5 Days

Rabbit Polyclonal IL-27 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IL-27 antibody was raised against a 14 amino acid peptide from near the center of human IL-27.
IL27 Rabbit Polyclonal Antibody
TA343044

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL27 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL27 antibody: synthetic peptide directed towards the C terminal of human IL27. Synthetic peptide located within the following region: AQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQ
IL27 Rabbit Polyclonal Antibody
TA321937

USD 345.00

In Stock

Anti-IL27 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
IL27 Rabbit Polyclonal Antibody
TA321938

USD 345.00

In Stock

Anti-IL27 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein