Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC22A8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC22A8 antibody: synthetic peptide directed towards the middle region of human SLC22A8. Synthetic peptide located within the following region: PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS

Anti-SLC22A8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 512-525 amino acids of Human solute carrier family 22 (organic anion transporter), member 8

Anti-SLC22A8 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 512-525 amino acids of Human solute carrier family 22 (organic anion transporter), member 8

SLC22A8 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human SLC22A8 (NP_004245.2).
Modifications Unmodified