Antibodies

Jump to Filters
View as table Download
WBP2 Rabbit Polyclonal Antibody
TA383291

USD 275.00

3 Weeks

WBP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 15-140 of human WBP2 (NP_036610.2).
WBP2 Rabbit Polyclonal Antibody
TA383291S

USD 85.00

3 Weeks

WBP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 15-140 of human WBP2 (NP_036610.2).
WBP2 Rabbit Polyclonal Antibody
TA334464

USD 375.00

5 Days

Rabbit Polyclonal Anti-WBP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WBP2 antibody: synthetic peptide directed towards the N terminal of human WBP2. Synthetic peptide located within the following region: MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQ
WBP2 Rabbit Polyclonal Antibody
TA366740

USD 380.00

4 Weeks

WBP2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human WBP2