Rabbit Polyclonal Anti-ACCN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the middle region of human ACCN4. Synthetic peptide located within the following region: NLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTS |
Rabbit Polyclonal Anti-ACCN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the N terminal of human ACCN4. Synthetic peptide located within the following region: SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA |
ASIC4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ASIC4 |
ASIC4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ACCN4 |
Germany
Japan
United Kingdom
China