Rabbit Polyclonal ATOH8 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ATOH8 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human ATOH8. |
Rabbit Polyclonal ATOH8 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ATOH8 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human ATOH8. |
Rabbit Polyclonal Anti-ATOH8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATOH8 antibody: synthetic peptide directed towards the N terminal of human ATOH8. Synthetic peptide located within the following region: PWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGL |
Rabbit Polyclonal Anti-ATOH8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATOH8 antibody: synthetic peptide directed towards the C terminal of human ATOH8. Synthetic peptide located within the following region: LRIACNYILSLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE |