Antibodies

Jump to Filters
View as table Download
B3GNT6 Rabbit Polyclonal Antibody
TA329578

USD 375.00

5 Days

Rabbit polyclonal anti-B3GNT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B3GNT6 antibody is: synthetic peptide directed towards the C-terminal region of Human B3GNT6. Synthetic peptide located within the following region: CSGGGFLLSGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAP
B3GNT6 Rabbit Polyclonal Antibody
TA373896

USD 220.00

3 Weeks

B3GNT6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human B3GNT6 (NP_619651.3).
Modifications Unmodified