Antibodies

Jump to Filters
View as table Download
BPNT1 Rabbit Polyclonal Antibody
TA344274

USD 475.00

5 Days

Rabbit Polyclonal Anti-BPNT1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BPNT1 antibody: synthetic peptide directed towards the N terminal of human BPNT1. Synthetic peptide located within the following region: DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP
BPNT1 Goat Polyclonal Antibody
TA303272

USD 375.00

5 Days

Goat Polyclonal Antibody against BPNT1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RNYDYYASRVPESIK, from the C Terminus of the protein sequence according to NP_006076.4.