Antibodies

Jump to Filters
View as table Download
GAA Rabbit Polyclonal Antibody
TA334653

USD 375.00

5 Days

Rabbit Polyclonal Anti-GAA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL
GAA Rabbit Polyclonal Antibody
TA376424

USD 220.00

3 Weeks

GAA Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human GAA (NP_000143.2).
Modifications Unmodified