Goat Anti-GRAMD3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QTPESENSRD, from the internal region of the protein sequence according to NP_001139791.1; NP_076416.2; NP_001139792.1; NP_001139793.1; NP_001139794.1. |
Rabbit Polyclonal Anti-GRAMD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRAMD3 antibody: synthetic peptide directed towards the middle region of human GRAMD3. Synthetic peptide located within the following region: LSRDSTYKLLKSVCGHLENTSVGNSPNPSSAENSFRADRPSSLPLDFNDE |
GRAMD2B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GRAMD3 |
Germany
Japan
United Kingdom
China