Antibodies

Jump to Filters
View as table Download
HMGB4 Rabbit Polyclonal Antibody
TA345518

USD 475.00

5 Days

Rabbit Polyclonal Anti-HMGB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB4 antibody: synthetic peptide directed towards the N terminal of human HMGB4. Synthetic peptide located within the following region: MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPNTYVGFKEFSRKCSEKWR
HMGB4 Rabbit Polyclonal Antibody
TA345519

USD 475.00

5 Days

Rabbit Polyclonal Anti-HMGB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB4 antibody: synthetic peptide directed towards the C terminal of human HMGB4. Synthetic peptide located within the following region: WSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRG
HMGB4 Mouse Monoclonal Antibody [Clone ID: OTI5G3]
CF808611

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HMGB4 mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
HMGB4 Rabbit Polyclonal Antibody
TA322036

USD 345.00

In Stock

Anti-HMGB4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
HMGB4 Mouse Monoclonal Antibody [Clone ID: OTI5G3]
TA808611

USD 379.00

In Stock

HMGB4 mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
HMGB4 Mouse Monoclonal Antibody [Clone ID: OTI5G3]
TA808611S

USD 159.00

2 Days

HMGB4 mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated