Antibodies

View as table Download

Rabbit polyclonal Anti-MAPK12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAPK12 antibody: synthetic peptide directed towards the N terminal of human MAPK12. Synthetic peptide located within the following region: SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE

Carrier-free (BSA/glycerol-free) MAPK12 mouse monoclonal antibody, clone OTI10E1 (formerly 10E1)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-MAPK12 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAPK12

MAPK12 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human MAPK12

MAPK12 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAPK12

MAPK12 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 248-367 of human MAPK12 (NP_002960.2).
Modifications Unmodified

Anti-MAPK12 (SAPK3) mouse monoclonal antibody, clone OTI10E1 (formerly 10E1)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-MAPK12 (SAPK3) mouse monoclonal antibody, clone OTI10E1 (formerly 10E1), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-MAPK12 (SAPK3) mouse monoclonal antibody, clone OTI10E1 (formerly 10E1), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-MAPK12 (SAPK3) mouse monoclonal antibody, clone OTI10E1 (formerly 10E1)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated