Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-Mboat4 (mouse) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CHLGLHYTEYYLGEP, from the internal region of the protein sequence according to NP_001119786.1. |
Rabbit Polyclonal Anti-MBOAT4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBOAT4 antibody is: synthetic peptide directed towards the C-terminal region of Human MBOAT4. Synthetic peptide located within the following region: FKLTYYSHWILDDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRIS |
Rabbit Polyclonal Anti-MBOAT4 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | FKSG89 / MBOAT4 antibody was raised against synthetic 14 amino acid peptide from internal region of human MBOAT4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey (100%); Orangutan, Marmoset, Horse (93%); Guinea pig (86%). |
MBOAT4 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MBOAT4 |
Active filters
Target Symbol
- MBOAT4
Reactivities
- Human