Antibodies

View as table Download

Rabbit Polyclonal Anti-MRM1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MRM1 antibody: synthetic peptide directed towards the C terminal of human MRM1. Synthetic peptide located within the following region: GTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQASCQ

Rabbit Polyclonal Anti-MRM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MRM1 antibody: synthetic peptide directed towards the C terminal of human MRM1. Synthetic peptide located within the following region: LVLGNEGSGLSQEVQASCQLLLTILPRRQLPPGLESLNVSVAAGILLHSI

MRM1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MRM1

MRM1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MRM1

MRM1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-353 of human MRM1 (NP_079140.2).
Modifications Unmodified