Rabbit Polyclonal Anti-GTPBP9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the N terminal of human GTPBP9. Synthetic peptide located within the following region: QGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQ |
Rabbit Polyclonal Anti-GTPBP9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the N terminal of human GTPBP9. Synthetic peptide located within the following region: MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWND |
Rabbit Polyclonal Anti-GTPBP9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the N terminal of human GTPBP9. Synthetic peptide located within the following region: GLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYH |
Rabbit Polyclonal Anti-GTPBP9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTPBP9 antibody: synthetic peptide directed towards the C terminal of human GTPBP9. Synthetic peptide located within the following region: QAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVE |
OLA1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human OLA1 |
OLA1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human OLA1 |
OLA1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 297-396 of human OLA1 (NP_037473.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
