Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-OR10G9 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR10G9. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-OR10G9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR10G9 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10G9. Synthetic peptide located within the following region: IYLRPGSRDVVDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLKLRDKVA |
Rabbit Polyclonal Anti-OR10G9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR10G9 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10G9. Synthetic peptide located within the following region: RPGSRDVVDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLKLRDKVAHSQ |
Active filters
Target Symbol
- OR10G9
Reactivities
- Human