Rabbit polyclonal anti-POU4F3 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human POU4F3. |
Rabbit polyclonal anti-POU4F3 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human POU4F3. |
Rabbit Polyclonal Anti-POU4F3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-POU4F3 Antibody: synthetic peptide directed towards the middle region of human POU4F3. Synthetic peptide located within the following region: ALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYR |
Goat Anti-POU4F3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EAAYREKNSKPE, from the internal region of the protein sequence according to NP_002691.1. |
Carrier-free (BSA/glycerol-free) POU4F3 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POU4F3 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POU4F3 mouse monoclonal antibody,clone OTI4D12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POU4F3 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POU4F3 mouse monoclonal antibody, clone OTI6H9 (formerly 6H9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POU4F3 mouse monoclonal antibody, clone OTI6F4 (formerly 6F4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POU4F3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POU4F3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human POU4F3 (NP_002691.1). |
Modifications | Unmodified |
POU4F3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human POU4F3 (NP_002691.1). |
Modifications | Unmodified |
POU4F3 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
POU4F3 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
POU4F3 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
POU4F3 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POU4F3 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
POU4F3 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
POU4F3 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
POU4F3 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POU4F3 mouse monoclonal antibody,clone OTI4D12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
POU4F3 mouse monoclonal antibody,clone OTI4D12, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
POU4F3 mouse monoclonal antibody,clone OTI4D12, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
POU4F3 mouse monoclonal antibody,clone OTI4D12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POU4F3 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
POU4F3 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
POU4F3 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
POU4F3 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POU4F3 mouse monoclonal antibody, clone OTI6H9 (formerly 6H9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
POU4F3 mouse monoclonal antibody, clone OTI6H9 (formerly 6H9), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
POU4F3 mouse monoclonal antibody, clone OTI6H9 (formerly 6H9), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
POU4F3 mouse monoclonal antibody, clone OTI6H9 (formerly 6H9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POU4F3 mouse monoclonal antibody, clone OTI6F4 (formerly 6F4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
POU4F3 mouse monoclonal antibody, clone OTI6F4 (formerly 6F4), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
POU4F3 mouse monoclonal antibody, clone OTI6F4 (formerly 6F4), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
POU4F3 mouse monoclonal antibody, clone OTI6F4 (formerly 6F4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POU4F3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
POU4F3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
POU4F3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
POU4F3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |