Rabbit Polyclonal Anti-RCC2 Antibody - middle region
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RCC2 antibody: synthetic peptide directed towards the middle region of human RCC2. Synthetic peptide located within the following region: RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT |
Rabbit polyclonal anti-RCC2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RCC2. |
RCC2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 323-522 of human RCC2 (NP_001129676.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
