Antibodies

Jump to Filters
View as table Download
RPL36A Rabbit Polyclonal Antibody
TA338016

USD 375.00

5 Days

Rabbit Polyclonal Anti-RPL36A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL36A antibody is: synthetic peptide directed towards the middle region of Human RPL36A. Synthetic peptide located within the following region: PHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLR
RPL36A Rabbit Polyclonal Antibody
TA381062

USD 220.00

3 Weeks

RPL36A Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 37-142 of human RPL36A (NP_066357.2).
Modifications Unmodified