Antibodies

Jump to Filters
View as table Download
SLC41A3 Rabbit Polyclonal Antibody
TA334149

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC41A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC41A3 Antibody: synthetic peptide directed towards the C terminal of human SLC41A3. Synthetic peptide located within the following region: WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFI
SLC41A3 Rabbit Polyclonal Antibody
TA368364

USD 380.00

4 Weeks

SLC41A3 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC41A3